DPCstruct | MC8279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 192 ± 38 aa |
| Standard deviation of domain lengths | 38.20 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7HTR3 | 1-136 | GSSGAPTRGGAHVLPTGRNFYSVDPKAIPSGLAWDVGCALADRLLERHLDETGTYPRTVGVVVWGTANMRTQGDDVAEVLALLGVRP… |
| A0A180FSK6 | 151-330 | TERTIQNIVSYKKALEQSPEKEFQSLLNALAGGYTAPSSGGDAVANPNAVPTGRNLYAINAEATPSELAWEKGVSLVDATLEQYKKQ… |
| A0A396QIY4 | 4-146 | None |
| A0A0Q3NW02 | 703-872 | None |
| A0A1E3H0K6 | 365-534 | None |
| A0A7J9T4V9 | 83-289 | None |
| A0A149TI91 | 512-777 | None |
| A0A7W2BGJ2 | 358-597 | None |
| A0A3C1ZYH9 | 11-162 | None |
| A0A2J7ZNA6 | 108-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.