DPCstruct | MC8278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 50 ± 4 aa |
| Standard deviation of domain lengths | 3.71 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0089 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6VKW6 | 7-53 | VDDAEVEKTTQTIISVAKTGKIGDGKVFVLPVDSAIRIRTEETGAEA |
| A0A180FS93 | 1-55 | MRDKNVEKTVQAIIKAAQTGEIGDGRIFVIPIEDAVRIRTAERGDIALYNAENEK |
| A0A452XWL3 | 55-104 | None |
| A0A1V4X7U7 | 44-96 | None |
| A0A200R131 | 47-96 | None |
| A0A1V5YNY3 | 2-45 | None |
| N9NGJ6 | 2-45 | None |
| A0A832GJI1 | 225-277 | None |
| A0A835PD50 | 1-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.