DPCstruct | MC8273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 149 ± 23 aa |
| Standard deviation of domain lengths | 22.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 93.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2HBA3 | 6-166 | VLMTGEALVGEGNEVAHVDILIGRRDGPVGTAFAIALGAPSQGHGGLTAIIAPNLAVKPPTVIIPTVTIKNMKQGELIYGPAQKAVA… |
| A0A6J7U7J9 | 4-142 | EYGEAFVGEGANAAHINTVLGDREGAVGTAWATGLATPSVGHTRFVAVAAPNQPLQPMTLFVNKATIDTERHGDLTWGAAQHGVARG… |
| A0A257WKA9 | 16-169 | None |
| A0A846PH61 | 66-226 | None |
| A0A7J3QSI0 | 129-292 | None |
| A0A177LBI5 | 20-186 | None |
| U6EEN0 | 2-126 | None |
| A0A5B8CS63 | 1-175 | None |
| A0A800BS71 | 225-365 | None |
| A0A7W0S0F5 | 3-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.