DPCstruct | MC8272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 110 ± 17 aa |
| Standard deviation of domain lengths | 17.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J6J618 | 2-82 | YVDQITWSQWGADGARGTGTYNVNDCEPDCADGTMLRGPVKITLSNPTEYKNKFYLRTLVIRSADGKNLPEMTSDTYEWDV |
| A0A6J7TX23 | 41-144 | IKNCGLVDFKPESLTVYCADAGIVITNLEWITWGSTEGTATGTYQANDCKPDCASGKWKSAKVEVRATNPEQIGAKTVLTKLTFRTE… |
| A0A246BJS9 | 211-311 | None |
| A0A1Y2N7T2 | 39-178 | None |
| A0A6J7EYQ2 | 12-133 | None |
| X8A4V9 | 27-166 | None |
| K6VMQ1 | 74-184 | None |
| A0A5N5W0W0 | 13-147 | None |
| A0A7J5D562 | 248-364 | None |
| A0A7J9YN52 | 8-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.