DPCstruct | MC8271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 136 ± 17 aa |
| Standard deviation of domain lengths | 16.58 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J6CRL3 | 306-446 | WDAKERQITVEVAAPHYFEDGITEVDGWLELKLKGTLVKHWWGISPQDATGYARVELLYSDGSTKIATVSAKYIPEFDWIDLRAYGF… |
| A0A6J7TF77 | 39-194 | VDPATNMIQVVSTGTHFDIFGDLITGWVEASIRGDMIRKVFKLEPKTMNEAIIEVTSSDGTPQAATYSTKYFSASDTVEIRGYGYHF… |
| A0A6J6BVQ4 | 231-358 | None |
| A0A6J6RH55 | 18-164 | None |
| A0A6J6VR70 | 219-376 | None |
| A0A7K1ARJ2 | 62-190 | None |
| A0A6J6T9Q6 | 1-122 | None |
| A0A6J6W6Z8 | 3-132 | None |
| A0A7K0UWR5 | 479-616 | None |
| A0A6J7L3N0 | 25-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.