DPCstruct | MC8270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 10.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7QZL6 | 1-124 | MNKKEVLEIRKQFTPDNCAITRICGCYVDHEKNIILESKDAFLSLPEEEEFKYFEIFRHTLSGTLGKNLVGMEFPLEQEEAGGTQEF… |
| A0A6N8HML2 | 1-128 | MNKKDIADIRKQFKLNNDLLKIHDIFNVYIMKESSEVYHQQSTSFELLEDEQKELFMANFKKVLTGQLDQKLFELKFQRDVEDSSQL… |
| A0A416NRS6 | 3-125 | None |
| A0A415ZKB6 | 58-178 | None |
| A0A1I3HFP6 | 4-143 | None |
| R6EER1 | 1-95 | None |
| A0A3E5AM00 | 1-124 | None |
| A0A6N9P6B6 | 11-133 | None |
| H1LSC8 | 1-108 | None |
| A0A3D4JLE4 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.