DPCstruct | MC827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 63.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RH78 | 235-318 | MGYSMEVEMISRAHSMGFLTTPYAFNPEEGAAMAKAGAHIVVTHMGLTTAGSIGAKTAATLDDSVARVQAIADAAVGVNPDIIV |
| U7QYL7 | 1-87 | MGYALEVKLIRLAHEKGMITTPYVFNAKEAEAMAQAGADIIVVHLGLKAGCDISANTSYDLKSCIPIINACASAAKTIRNDIIRGPG |
| A0A2T5M1Q4 | 146-215 | None |
| A0A0F8WTX0 | 625-694 | None |
| A0A212DP95 | 143-214 | None |
| A0A7J0EUQ5 | 568-639 | None |
| A0A6G1DWB2 | 422-505 | None |
| A0A0F9Z9E7 | 144-215 | None |
| A0A5N6NJR6 | 613-684 | None |
| A0A103XKG2 | 551-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.