DPCstruct | MC8269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 136 ± 13 aa |
| Standard deviation of domain lengths | 13.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A142XXG9 | 140-274 | EDRVRFVMQSAADLFGVAPTWTAFYRAVLGGEGVLRKAITAGDEATQFECSEEHSKLLSMLTTLRSRDLPENDPFEPQRMITVRIPK… |
| A0A518I8V1 | 2-113 | STKAKELLKFAQELAPSISDWYSFHNALFGIHGKLGKLFKTQEEREAFFNTIEYRKIDKLAKDIEQRQNDSKEAKILVRLPESLKEQ… |
| A0A3C1QQP1 | 1-150 | None |
| A0A3E0PQR8 | 1-124 | None |
| A0A7V3NBU6 | 5-154 | None |
| A0A518CU04 | 6-125 | None |
| A0A518HMZ6 | 267-399 | None |
| A0A257SUG2 | 16-136 | None |
| A0A2H0RVR7 | 34-160 | None |
| A0A7C5G0A0 | 49-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.