DPCstruct | MC8266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 168 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A347UDX0 | 1-169 | MRLVFWLIFAVTMGIYLTMVLWSLPYITAEANGLLPFDLRLIGYGFDDAAFFREAISEEGRQFYLTVQQSLDGAYPGLMAVTLVMAF… |
| A0A524FC52 | 12-171 | NKILGLIILIAGISFFLLTFLVFGPIEAELKGSTGYGVMEFEFAWTSENINKIFTAWGQDGINKQIFVTWIDFLYIPSYGFFFSGLI… |
| X5MDY4 | 40-213 | None |
| A0A3G1J119 | 20-195 | None |
| A0A147E8F8 | 3-159 | None |
| A0A5F1YD11 | 202-383 | None |
| A0A800BAS4 | 46-227 | None |
| R1FCQ2 | 344-501 | None |
| W2EKU0 | 10-187 | None |
| K0RK80 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.