DPCstruct | MC8265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 61 ± 8 aa |
| Standard deviation of domain lengths | 7.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 59.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7R2L9 | 1-45 | MGIVKISEDMHENLRISSNALSRSINAQAEHWMRIGMLAELHPNL |
| A0A7Y0Z5D7 | 1-55 | MGIVKITDQLHEQLRLASAAMDRSINAQAEFWIKIGLLAELNPHLPYNELINKLL |
| A0A844W9F4 | 1-53 | None |
| A0A4R2TCA1 | 1-59 | None |
| A0A7Z0MDD7 | 1-64 | None |
| A0A501SA43 | 1-74 | None |
| A0A8A6BFK8 | 1-65 | None |
| A0A1I0CP26 | 1-61 | None |
| A0A1I4PRQ2 | 1-61 | None |
| A0A7Y4C320 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.