DPCstruct | MC8264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 7.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6I8U5 | 6-121 | RLYAVRGAVCCQNTVASITQRVPELYRKITEDNTIESQHIVSVQFSVNPELTALNPATALRIKGLAQDVPLFCSAEPYIDGYLKNII… |
| S3L1T6 | 4-117 | KRLYGIRGAVCTENTAEDMQKAVADLMGRIFEKNALCEDDIVSVQFTLTGDLDCANPASVLRKSGLCTGVPLFCAAEPVVKGALAHT… |
| A0A2N2JMW1 | 3-118 | None |
| A0A6J6YFF8 | 2-98 | None |
| A0A1H8L1D9 | 6-110 | None |
| A0A0K1PE21 | 2-110 | None |
| I8U2T6 | 46-161 | None |
| A0A524AG75 | 2-119 | None |
| A0A7C4X051 | 18-146 | None |
| A0A7X8FQ75 | 2-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.