DPCstruct | MC8263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 115 ± 7 aa |
| Standard deviation of domain lengths | 7.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V2WS09 | 7-121 | FAEPPVAVVTKDAALQPPAPKGLKYVHLTDPDTLDEDNAHYPVLTIANYSFWALSYDDNREGLAILAYDQDNKLDRQWEFTGARYLV… |
| A0A0D8D4Z6 | 105-215 | NVPVLNRVTSGSHPEIPEELIEGFSDGAESLDFSDNCEVIHWNGYTYWAFSYMDNRESLAIVAFDNDGQLVGKIEKKGAHFLWQISL… |
| A0A0K9YYJ1 | 5-110 | None |
| A0A5B1R9N7 | 330-444 | None |
| A0A5C3M2B4 | 79-190 | None |
| A0A5K1K893 | 2-113 | None |
| A0A4Q5LPD6 | 224-363 | None |
| A0A563U768 | 1-115 | None |
| A0A4U1JIF0 | 93-207 | None |
| A0A1R0WAH8 | 262-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.