DPCstruct | MC8262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 2 aa |
| Standard deviation of domain lengths | 2.06 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10982 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8D4G1 | 1-69 | MACLFAQLGLDNKDTCINDFINKNKGIPADVHLANAGFWNPAQADFLTQAIVEDSDWAEIVDSLDNLLR |
| A0A2A2AVG9 | 12-84 | CASFSDLFEQLGLPSSPVQIADFITEHHPLPDEVLLADAPFWSTAQAQFLREQKQLDEPPWAILIDQLSAALR |
| A0A2T6FR53 | 12-88 | None |
| A0A2A5AGJ4 | 31-106 | None |
| A0A2E2KNP4 | 1-76 | None |
| A0A1B3LL30 | 1-77 | None |
| A0A4Q5Q8E8 | 1-76 | None |
| A0A1F8W2F6 | 1-76 | None |
| A0A1G7E2F7 | 67-142 | None |
| Q8PMS2 | 37-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.