DPCstruct | MC826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 228 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A235HNY2 | 36-241 | NPLMLRLLEDPRILPNPEHLQPVATEIEVSNVWWQRVVIGQNLVVGEAREQILRNIGEQAVKSPGIRLRIENAYPEAVVSLKLDRIL… |
| U7QW82 | 1-216 | MLYIPFYIELAVRAINNGAEFEPDVSEKDFRNIIWQSVIACNVDRKFGMPARRKSTFIEIAKKRAKQMLYGVDESLFDPEVVAKLEE… |
| A0A0C2QU76 | 1-211 | None |
| A0A554VAS6 | 29-269 | None |
| A0A1F2UVG8 | 273-496 | None |
| A0A2D6I9W1 | 486-729 | None |
| A0A3R6UTU0 | 1-246 | None |
| F9EN70 | 118-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.