DPCstruct | MC8259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 10.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A231PLP8 | 4-86 | LSGLQTEGAVCVWCGASLVPHTARDLGARPGPDGVTIFPRGCAGCVRATASDVYRIHVAACSTCLRNQPCTDRQALCRLASEG |
| A0A6L6WRG1 | 12-101 | FVVPGGMLLTPQQNAGQVCVWCPRSLHPGEGVDLGGSGPWWPHACLSCYEAQTRVLATYLDWADHADGCTLCKAAPPCDTAHTMGTD… |
| A0A2U3H9J9 | 2-93 | None |
| A0A060ZII9 | 1-111 | None |
| A0A1I1UQN8 | 66-147 | None |
| A0A7X9Z4H1 | 13-108 | None |
| A0A4P8T8V2 | 18-135 | None |
| A0A7K3QRE6 | 27-124 | None |
| A0A1H5KYL3 | 114-207 | None |
| A0A4Z1DAP7 | 22-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.