DPCstruct | MC8258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 17.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A231PCA3 | 6-124 | FPAAADTPLVDLMFTVGHSLHGLRTEGAATIDFTENTYVIRLELVGDRVRFTASHDAPAPAPGCPLDTYACEARRFVTDGVEYLERQ… |
| A0A318CC52 | 29-122 | IDELWLDFLDAALLLKKEGHFAFSFPDQAIRVTGVEMDAGHFQFEIRANSVKAAILEKDVFCQALLAGAREFCQHLCRLSPQHDILD… |
| A0A4Q9I482 | 10-115 | None |
| A0A1I6FVW9 | 51-149 | None |
| J4KCY9 | 152-248 | None |
| A0A7K2Y0H7 | 22-120 | None |
| A0A7X6M3I3 | 19-124 | None |
| A0A4R1W811 | 65-156 | None |
| A0A1Q5GQ79 | 61-155 | None |
| A0A1V4ZYT0 | 64-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.