DPCstruct | MC8256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 12.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A426UI22 | 17-132 | YPLADKILAEKKILLKRGDGHITLADCVSGAGLLEIMARDKADKICFKVVGDSGWLTLEIPAVYAIKGNDYTTAVDMTVGAEEKSFD… |
| A0A4Y8NJU8 | 1-111 | MIKLIRGDGNIVLADCDSSDRSQINVQVTRGPDEQDKPKLFCFRVTAKSGFLTLEVPRVFYIETADHPVSAKLTTDAGDSQTVNVAK… |
| A0A495VZE4 | 113-265 | None |
| A0A2L0N2F3 | 66-194 | None |
| A0A223G959 | 18-129 | None |
| A0A1G9VC96 | 21-156 | None |
| A0A0N0N4M0 | 65-205 | None |
| A0A4S2TC61 | 5-124 | None |
| A0A1I5KWW3 | 49-187 | None |
| A0A7U9KQW2 | 30-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.