DPCstruct | MC8253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 182 ± 17 aa |
| Standard deviation of domain lengths | 16.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 48.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372QS24 | 517-703 | DDFPITKTNMDDIYARLAITSGNILQIDDHGKVSSVLKKVEKEINKKKLNEAAAPNITLENIYGKLNGTNDINHTIYYEKNINFKQI… |
| A0A2N0NCT6 | 1-162 | MDDIYTRLAITSGNILQIDDYGKISSVLKKFEKEINKKKLDKAAVNDREPWLPGGSKRTSYCLYYNEEGTKTETLQLIVSRSTVQIW… |
| A0A015JU80 | 1-221 | None |
| A0A2N0S363 | 537-706 | None |
| A0A2I1ES84 | 3-189 | None |
| A0A015IKL7 | 71-244 | None |
| A0A2I1EAW9 | 164-337 | None |
| A0A2P4PMF6 | 166-336 | None |
| A0A372QE77 | 106-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.