DPCstruct | MC8252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 53.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0NBC8 | 1-85 | MDIHKTVLNLLTGRWIDPNGKLFQKLIREGFRYADRLLDYLEDIGTIYVDEFELDSLADFYYSAIIPPLSILARSNICKKNNLGT |
| A0A2N1MJS0 | 59-150 | QESDIHRTVLNLLTGRWISPNGKLFQKLIREGYRYANRLSDYLEDIGTICVGEFELDPLADFYYPALIPPLSILASRSDIHKNFPIT… |
| A0A397J5X1 | 76-171 | None |
| A0A397JKD0 | 1-97 | None |
| A0A397TVF5 | 7-91 | None |
| A0A397UMR0 | 55-137 | None |
| A0A397TD33 | 1-81 | None |
| A0A2P4P6R6 | 6-100 | None |
| A0A372RP96 | 72-162 | None |
| A0A2H5TPY5 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.