DPCstruct | MC8251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 185 ± 29 aa |
| Standard deviation of domain lengths | 29.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372QEC6 | 143-313 | MRFAKFEEWLEKTGIAEVKNREYNTMKYFKEILHMEESIAEEKNREKVKKFQKSITYKWWNNKYGKIWESNKITNMIIAKIIEKKGF… |
| A0A372QSJ5 | 2-133 | EENIAEEENREKVKKLQKTKIIKEKGFIEEYSDVEELISSDDTEESENLDEHFEMILRNYWIENGYEIDIKEIIQILDFGVEHEIMK… |
| A0A372Q6V7 | 4-223 | None |
| A0A015KG84 | 173-388 | None |
| A0A2H5T0R8 | 73-223 | None |
| A0A2H5SFJ7 | 20-226 | None |
| A0A015L700 | 12-193 | None |
| A0A372QB95 | 24-211 | None |
| A0A372Q6M3 | 17-235 | None |
| A0A2N1M9T1 | 13-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.