DPCstruct | MC8250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 89 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1HS67 | 16-99 | EIPIFYGVIGKNPKEWADQVEKYLLKIGIKDDKRIFEIAKTHLLGDALQWLENEGMCIADWDKNEIKWLRLKYRLIEKYSENKN |
| A0A2I1HVI9 | 62-144 | MEIPIFYGVIGEDPKEWTNQVGKYLSKIGIKDDKRIFEIAKTHLLGNALKWLENEGICVADWDKNEIKELRLKYRLIEKYSDN |
| A0A2H5RJE3 | 222-313 | None |
| A0A015ND16 | 162-242 | None |
| A0A2H5STF1 | 496-588 | None |
| A0A2Z6R6H6 | 172-251 | None |
| A0A372QB95 | 325-415 | None |
| A0A2N0P6I1 | 595-684 | None |
| A0A2I1HRN1 | 1-98 | None |
| A0A2I1HND0 | 358-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.