DPCstruct | MC825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 115 ± 7 aa |
| Standard deviation of domain lengths | 7.08 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7YF49 | 18-133 | GGGVVVMFDHNNSPRGGSGIKVDGDLTIKKDYYPWTSETFLGRYTKDINLAGEGDIYLMYRALQARQVYFEPIVHSDFMVSSEGTKV… |
| U7QR21 | 9-120 | GTGLTAFINDATQTNISENEELNILDYHPAIYPVLEISDRFPKSIFLQGESGMRPFRFRLTPGAEWKIIYKPKLDETKMPKIIIPPG… |
| A0A5A9D0Q5 | 101-218 | None |
| A0A7W7NLC5 | 1-120 | None |
| A0A2V4ZV73 | 17-134 | None |
| A0A827UGQ5 | 36-152 | None |
| A0A0T9QNK4 | 75-187 | None |
| A0A4U6M3Q8 | 2-97 | None |
| A0A5E7K110 | 81-198 | None |
| W3V525 | 2-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.