DPCstruct | MC8249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 172 ± 19 aa |
| Standard deviation of domain lengths | 19.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5RHB2 | 72-222 | APNSSFSPSPYCPIPDMPFPPQYWDIIPPDPIYDKNDNFIVPGSHEWFSYMHNLSKIHIANNRKAETTQLTIDQKAKARDKRLQELA… |
| A0A2P4Q5T1 | 5-167 | NKNSQEVYHTVAPYRPYPDMFIQHKYRNIIPKDPIYDNTGNFIIPGSREWFTYMHNLHQSGTIPIPILTGQVTQYEYYAEQAAEQDR… |
| A0A2N1NEU8 | 55-246 | None |
| A0A2I1GPG2 | 16-216 | None |
| A0A2I1GRY3 | 456-657 | None |
| A0A2I1H2P9 | 1-173 | None |
| A0A2N1N0P3 | 117-272 | None |
| A0A2N0R5N2 | 22-193 | None |
| A0A015LAD0 | 10-196 | None |
| A0A015KM18 | 25-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.