DPCstruct | MC8248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 189 ± 16 aa |
| Standard deviation of domain lengths | 16.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1HMZ8 | 8-215 | KSGYKSILGLNKIKVLDTNKESTPDTTEEEIKKNIEMLNEKLKHPLGDDDGPLYSALKKTVENIVLSDLTWRDPVANIVLSDNSYIV… |
| A0A2Z6S628 | 1-199 | MLMGFDDAYEGVSSLRNIKESKQEEPLTKNEIETNLRVLKTNLKNSKAPYTHHFRKYLKKKSASDLSWRVPLASQVICADSEMVRTL… |
| U9SXQ1 | 6-172 | None |
| A0A397I7V5 | 67-268 | None |
| A0A372QBK2 | 38-214 | None |
| A0A372QA51 | 63-238 | None |
| A0A372Q6W8 | 6-183 | None |
| A0A397U1N7 | 50-273 | None |
| A0A397TSC0 | 20-186 | None |
| A0A397J9U9 | 195-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.