DPCstruct | MC8246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 150 ± 21 aa |
| Standard deviation of domain lengths | 21.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 35.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9SZB8 | 7-137 | TSRRVESKGLGDDSSCMIVDTFVDESVRRNLASSISYDLPTNSADPEKLGCYYRCVAKFGFNHIIVIGGLSCGLLFIDCYKRVFQWE… |
| A0A2I1HI87 | 23-179 | GKLLRVDTIVSPRLPCQFVSPGDQPKKNEQETKDYNMIVEIIMNKNDRDRVINSLNLFLDRAPKNPNDLVNYVKTKLSYYFKEIKSY… |
| A0A2Z6QGF1 | 589-732 | None |
| U9TCX8 | 42-172 | None |
| U9T9A0 | 93-271 | None |
| U9T3D8 | 1-145 | None |
| U9SRM2 | 154-322 | None |
| U9SRH5 | 97-265 | None |
| A0A372QKX2 | 39-212 | None |
| A0A015NJX7 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.