DPCstruct | MC8243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 141 ± 20 aa |
| Standard deviation of domain lengths | 19.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.45 |
| Pfam Score | 78.85 |
| Assigned Pfam label(s) | CL0221- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1HHF2 | 18-143 | TLALITGYKPVLETAVDLGLFSKLFDPNNVSNPAFTSLNPYYKIITYGYGPEILYYGFNKMKILQLSGGEISNWKTKEMMRFFYDIG… |
| A0A2N1MDZ6 | 84-228 | VLVLVAGDGDYEPALEEILKAGWKVEIRFWASAISRHLKVPEITRNNIELKTIFKPLDKEYQNFTFCVGPDLTRNKSVFRIEREDMN… |
| A0A7R9M0L1 | 1-130 | None |
| A0A015MNP2 | 2-143 | None |
| A0A2Z6QG57 | 308-460 | None |
| A0A397JP02 | 170-281 | None |
| A0A397SEC2 | 238-395 | None |
| A0A2I1GPP1 | 118-257 | None |
| A0A2H5SNU0 | 4-134 | None |
| A0A2H5SW78 | 371-538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.