DPCstruct | MC8242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 128 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0QN71 | 100-220 | HAPSNTDGKGKAVAFDIPERQPSPDGNTAAIKSAPSRYHAAAYLRDVPDAFKAKFNTNRSMCDEVDCSLSRYSSYGARTRCDESGDN… |
| A0A2I1HGK4 | 1-120 | MQPLNTSPDMDTNGAPSSDQSLDPTPTFSISRQDFQAAAAPNAAFESLIKFPTNKELINAVNNHFLEVYESYTGKARMTGSGDAKRL… |
| A0A015KFQ4 | 3-129 | None |
| A0A015KAB1 | 33-182 | None |
| A0A015JXH5 | 1-118 | None |
| A0A015JWZ1 | 2-111 | None |
| A0A372QAS8 | 71-209 | None |
| A0A397S8B0 | 122-252 | None |
| A0A2N0QVB8 | 113-249 | None |
| A0A2Z6R128 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.