DPCstruct | MC8241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 61.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1HFD7 | 2-99 | THRKEIAKFWDDRISAFSSLKTLPDSFCDEFSALDCWNFDTPSASCLWLTRGLLPAHLTTFLREYFLLSTIYKIISSLLNDFQLELY… |
| A0A2H5UGG5 | 803-922 | LTHRSEVIKFRDSCLSSFLSLKSLDNSFHTEFFALDCWNYEAPSSSCLWLTRGLLPAHLTAFLNQYFPLSVIYKIISPLLNDFQVEL… |
| A0A2N1MT22 | 85-204 | None |
| A0A2N0RDR0 | 240-338 | None |
| A0A2N1M9M6 | 182-295 | None |
| A0A2N0QYM0 | 206-325 | None |
| A0A2H5U1S4 | 45-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.