DPCstruct | MC824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5BNI3 | 143-207 | PTRPMRVSDHARVRYLERVKGVDIEKLDAEILSPAMSLADDMGGGKVIMKTGHKAVVRDGVIVTV |
| A0A494TJU5 | 1-70 | MYVSDHAVLRYIERVIGLDVEAVRVKIASPTVQKAVDFGCETVVLGTGQRIILHGDVAVTVLPKGARGTR |
| A0A105V492 | 58-125 | None |
| A0A2W5N350 | 1-67 | None |
| A0A437M7K2 | 4-79 | None |
| A0A5N7MVN9 | 52-122 | None |
| A0A2E6KNF8 | 49-110 | None |
| A0A0P0P281 | 21-89 | None |
| A0A7L5XUD8 | 1-74 | None |
| A0A2W4UZX1 | 5-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.