DPCstruct | MC8238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5KB02 | 3-82 | KLRVLGEWEEVVGTLERLFKAANGTIVKLSGSMYMLKDFPDELALQLTKLLGRKVGILKKERGYAIRAIGKTRSRGYPLI |
| A0A5E4IZL6 | 2-71 | TVLEIHRLQPWEEARGPLQELQEQDGCLVARIGPAVVALPDELREKLQGLMGKTVGILRTDFDYRLMVLE |
| A0A5E4IST2 | 4-82 | None |
| A0A843C052 | 6-86 | None |
| A0A7J3ZRH2 | 1-69 | None |
| A0A3G9G326 | 425-499 | None |
| A0A1V5AQV2 | 42-112 | None |
| A0A1V5APD3 | 13-85 | None |
| Q0ZB26 | 250-323 | None |
| A0A7J3J362 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.