DPCstruct | MC8234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 178 ± 25 aa |
| Standard deviation of domain lengths | 25.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7F5K8 | 68-214 | IQEDSGSDIAPMQTDDQLKQDLYVPGPDEKPLFTPEPPTLEDLCLLAELFYLPYEHGPKASQMLKEFNWLRANSSVVSVNCKRKESE… |
| A0A2V6PDV4 | 1-186 | MYADADADWDPRAAYQSALKGWLLSWKTHKTGGISMHELELFCDCFYLPFQSGSRAEAFLGDLQHLLKTPPGDWGAAGRRFEQLCSD… |
| A0A2R7VRS7 | 239-419 | None |
| A0A833S617 | 68-199 | None |
| A0A814JL10 | 632-806 | None |
| A0A553PKQ6 | 362-557 | None |
| A0A817SCZ3 | 1-218 | None |
| A0A553PY93 | 151-359 | None |
| A0A7R9CCV0 | 181-357 | None |
| A0A553PY90 | 151-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.