DPCstruct | MC8233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 136 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z8LF97 | 142-281 | DAIPLDQMSVSMTMNGAVIPILANFIVAGEEQGVSRDKLSGTIQNDILKEFMVRNTYIYPPEPSMRIVADIIEYTAKEMPKFNSISI… |
| A0A379T6Q9 | 35-170 | DKMSVSMTMNGAVLPVMAFYIVAAEEQGVSPEQLTGTIQNDILKEYLCRNTYIYPPKPSMRIIADIIAWCSGNMPRFNTISISGYHM… |
| A0A535AGQ0 | 148-282 | None |
| A0A0V0S6J5 | 172-306 | None |
| A0A7D9E586 | 180-297 | None |
| A0A7J5D4P2 | 132-268 | None |
| A0A1V9ZCN3 | 158-297 | None |
| H6SM39 | 360-496 | None |
| A0A419G259 | 53-181 | None |
| A0A1C4NIW9 | 75-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.