DPCstruct | MC8232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 103 ± 23 aa |
| Standard deviation of domain lengths | 23.32 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.97 |
| Pfam Score | 96.81 |
| Assigned Pfam label(s) | PF00137- CL0507- CL0208- PF02931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4DBY2 | 7-104 | LQPVARRAVATSPSALVVRRASTVAISVQGLHYVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGL… |
| A0A6P0ZEH4 | 2-71 | ELESLKFIGAGLTVFGMMGAAIGVANIFVALLNGIARNPSAEPKLKKYFIIGAALSEFMGLLAFIVAVLI |
| A0A4S9VJP8 | 13-139 | None |
| A0A3S1AAN6 | 29-152 | None |
| A0A2G8LDF1 | 37-157 | None |
| A0A1I8I7A0 | 1-112 | None |
| G3J7T6 | 12-125 | None |
| Q4Q9E5 | 130-251 | None |
| A0A337SCQ1 | 32-150 | None |
| A0A4Z2GI48 | 38-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.