DPCstruct | MC8231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 368 ± 74 aa |
| Standard deviation of domain lengths | 73.77 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 67.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 87.59 |
| Assigned Pfam label(s) | PF15017- CL0167- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J4D5B4 | 2-283 | TPGIQMELEKYRQKNPLEAVIRTVFTPVIREPADEDVIFVRKFASLTGDLQYLSKVDIECIALTRRLQIESGDTSKLRETPMTLKID… |
| Q4D153 | 52-387 | VGTAIPAYQKGLLILDANAFIKGMDNFSDVADVLVTTPQVVAEVRDRAARELLSRFSQVLHVLEPSKEAIAAVVSVAEKTGDLGAMS… |
| A0A7I8K1Y6 | 1-364 | None |
| A0A0D3CT80 | 1-235 | None |
| A0A7S3G7P3 | 153-570 | None |
| A0A2R6X669 | 227-527 | None |
| A0A818SHL0 | 12-361 | None |
| A0A2P6RLV5 | 57-436 | None |
| A0A6D2L598 | 29-485 | None |
| A0A2C6L027 | 1-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.