DPCstruct | MC8230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 165 ± 35 aa |
| Standard deviation of domain lengths | 35.23 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9V270 | 158-287 | WHLLMKAKASLLKFRLSWKEGITNYLKGDIYLPIWGPMTTTEARLLVEGTEMQGYDNQKYEQQMFFFNTVARVARYEHDVKAVGIDF… |
| Q4CXM1 | 10-211 | GEYSMLKFRLPYTHKKIGFGDSSRKVNSSLIGPDGTVNYLRGDILLPIWTRPTSTEGRLVVPRGAHRVPYKVAQVENCFFFFNARVR… |
| S9UZR8 | 45-190 | None |
| A0A6C0JQD0 | 180-375 | None |
| D2VMH7 | 375-509 | None |
| A0A3M7RW95 | 170-399 | None |
| A0A820AY80 | 352-509 | None |
| A0A815DLS5 | 924-1061 | None |
| A0A814GBK1 | 204-337 | None |
| A0A3M7RWP2 | 217-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.