DPCstruct | MC8229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 216 ± 29 aa |
| Standard deviation of domain lengths | 28.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 51.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061IW61 | 168-403 | TNSDVTFSPEIFPNLLNDTYTMTKHDAARMDELAAEVANEPNEHSRGSRRKMKVLRSTPKDNLLSTSALLPDRVRYAPPDVRGKEFS… |
| Q4CTU5 | 6-245 | VTTSDVKFHPDLFPNPLRDVHEMARHDAACMDELAAEVANEPSEYSPVLRRGLRVLRSTVKDSRLSTSALLPDRIRYASVKEREKAF… |
| A0A0N1IJD9 | 265-546 | None |
| A0A061ISF8 | 6-215 | None |
| A0A0N0DWP9 | 177-381 | None |
| C6K3M7 | 661-904 | None |
| A0A2V2VP42 | 6-213 | None |
| A0A2V2UKY8 | 113-317 | None |
| A0A2V2XEI1 | 1-188 | None |
| A0A836KBF9 | 26-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.