DPCstruct | MC8227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 165 ± 24 aa |
| Standard deviation of domain lengths | 24.48 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1EC19 | 8-175 | APLERTMSVAHANLLALLWLPVAGAMVYFPFSARWGPAPLADAFAIPLIRSLPAVAAGILVHELCHAAGFRLAGRAPRSAVRIGLNR… |
| A0A1F8VUC2 | 9-147 | WTLLTPPFDLVFESGDKVTVAIASVILLGLVLQISTYPRMGLSEESVFGLWPSRLTLYTAHASQLTKRQCIATLLLPFIVLSILPIL… |
| A0A5E4L2Z4 | 24-201 | None |
| A0A2N6A259 | 5-144 | None |
| L9ZLU3 | 7-171 | None |
| A0A3M1BM29 | 142-325 | None |
| A0A6N7XKN4 | 6-129 | None |
| A0A0P6XBB1 | 6-182 | None |
| A0A2P6C4X0 | 7-162 | None |
| A0A533MMA7 | 10-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.