DPCstruct | MC8223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 137 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6UXG5 | 1-147 | MNAFSFAEMLVAMVAIAVVISMLLCYKSLREAKDWSLTDALSEDVTLTRTDQAGNPVDAAGNLLAAGQPPLAVTLMKASSSRFIALI… |
| A0A3G2I9D7 | 40-182 | FLYLIPGVVIFGSLIAILAIRGSLPKEWSLADALSEDVLLPAFIEVTTKDQDGVPVVTRQPIYDKNGTPVLVPVMKASSSRLIALIG… |
| A0A496Y453 | 131-267 | None |
| A0A7Y0A260 | 33-153 | None |
| A0A2V9XYM5 | 34-168 | None |
| A0A2N9N4B5 | 1-155 | None |
| A0A2N5ESF3 | 2-149 | None |
| A0A533U0H6 | 84-226 | None |
| A0A3D8P779 | 1-118 | None |
| A0A5E4XE12 | 70-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.