DPCstruct | MC8222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 6.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2MJL7 | 4-83 | KIDIEMLSTFYRELNELLGTPAMLKFYQFYRGTQITLPVHLYDRKRVKAGLRAQYNGHNSNELAQKYGYSQRWVNNQVRH |
| A0A2V2EBU1 | 7-95 | WLRDTDPALLPEQHRKIAELIGYDKMLNLVSTYSGDYLYIPKLDAIIRAVRNKSLIEDHRKGTAPLELAHKYDLSVVQVYEIIKRAQ… |
| B0MN73 | 77-165 | None |
| A0A7V2F0R6 | 33-110 | None |
| A0A3T1GSE1 | 2-69 | None |
| A0A399W6X8 | 3-74 | None |
| A0A1V5XJ64 | 12-96 | None |
| A0A399INU1 | 1-95 | None |
| A0A2X0SC63 | 4-86 | None |
| A0A371J435 | 3-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.