DPCstruct | MC8221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 61.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2M3X8 | 1-70 | MVPDSVYVLKFGKDHRNNRVVVKYSHTWTGRVKINEIAVRLHKQKHPRIFKHEADMVKYLNKHLTKRTLE |
| A0A660EBA7 | 25-88 | MVPDSVYVLKFGKDHRNNRVVVKYSHTWTGRVKINEIALRLHKQKHPRIFKHEADLVKYLNKHL |
| S4NF68 | 1-69 | None |
| A0A0R2G5V7 | 2-62 | None |
| A0A0R2JWC3 | 1-78 | None |
| A0A0R2BDI2 | 75-141 | None |
| A0A511DQZ2 | 56-124 | None |
| A0A4Z0J922 | 25-102 | None |
| A0A0R1TZA1 | 2-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.