DPCstruct | MC822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 236 ± 23 aa |
| Standard deviation of domain lengths | 23.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1IW87 | 154-377 | FPPSAHQQLKMMDINNDEFLDSHEILTGISALKNERNKSRMYFNFLIILGILFILTQAAVFGLTYAVIEITKDSEVKAGGVMTVKGT… |
| A0A150GZC7 | 7-236 | FRTPHRIILKKYDNDNDGRIDATEIQSVVDALMTEQFRSKAFKIGLIILTLFTIVLLGALFGLTWAVVAALKDTQVDGELLVTNDKA… |
| A0A7S0WPC2 | 2-221 | None |
| A0A835XRD3 | 50-325 | None |
| A0A7S2XYJ0 | 9-210 | None |
| A0A5B8MFG7 | 7-204 | None |
| C1FF20 | 71-261 | None |
| C1FGJ2 | 36-238 | None |
| A0A830HXS1 | 89-325 | None |
| A0A830HD23 | 103-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.