DPCstruct | MC8219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09888 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A8RSD2 | 49-113 | EFREFIKIISVYLTFIEKRPLHPPGIIFSDGDTVYEHNGIYYCTGKKQFKKEDHSLCNFCVCHEI |
| A0A7J4MXL2 | 10-73 | PEIVGLTVLYRTYVKGEPLHPPGTPFPGGFEVEEKDGVYYCPVKDKQKDNPEALCDICIARQTP |
| A0A843FDU1 | 1-57 | None |
| A0A1D2WDF9 | 11-79 | None |
| A0A1V5Z5E7 | 9-87 | None |
| A0A0U3FYZ9 | 97-159 | None |
| A0A7C4XVI8 | 135-195 | None |
| A0A843J0W3 | 30-97 | None |
| A0A497ILV4 | 175-236 | None |
| A0A7J4KAF3 | 41-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.