DPCstruct | MC8216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 120 ± 17 aa |
| Standard deviation of domain lengths | 16.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 42.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7KGW0 | 13-117 | MLEGVESALGLSKGSLPKPFYTRLQLWGAVFPTNTHGVPCIFDPFGRAGICGDWLLGSNIEAAVLSGIALANHIADYSQSPGTDPGE… |
| M1CMN3 | 1-126 | MLEGVEKALGLSKSSLQKPFYTKLQLWGAALPTNTPGIPCIFDPRGRAGICGDWLLGSSLEAAALSGIALADQIADYFEQGGPCSDE… |
| A0A7S0S6U3 | 45-180 | None |
| A0A1J6JW90 | 16-126 | None |
| A0A0M0K3T1 | 203-363 | None |
| A0A7S0GP95 | 15-125 | None |
| A0A2H5PVB4 | 4-101 | None |
| A0A2H5PUI9 | 280-400 | None |
| V4S9X1 | 5-100 | None |
| A0A2H5PUI2 | 166-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.