DPCstruct | MC8214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Standard deviation of domain lengths | 4.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 53.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1KH22 | 76-129 | LYAYSEATVPKITVILRKAYGGAYVALNSKSIGADVVYAWPNAEVAVMGPQGAA |
| X6MWG4 | 189-243 | VNAVACAKVPKITVLCGGSFGAGNYGMCGRAYSPQFLYMWPNSRISVMGGAQAAY |
| A0A448WGX1 | 70-124 | None |
| A0A1S3W1T7 | 198-251 | None |
| A0A4Z2EL90 | 180-235 | None |
| A0A6G3V8R1 | 84-149 | None |
| A0A0A9DT15 | 19-73 | None |
| A0A098VRQ7 | 351-399 | None |
| A0A1I8AVL6 | 326-379 | None |
| A0A7K2KM60 | 399-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.