DPCstruct | MC8213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 69.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1CCV6 | 1-72 | MEPGKSEEFVTEEELRDKLKSWLENWPGKTLPPDLARFEDTDDAVEYLVKSVCELEIDGDVGSLQWYQVRLQ |
| A0A7N2KYY2 | 396-467 | MEPGQEERFVSEEELKAKLKDRLENWPGEALPPDLARFENIDDAVLFLVKSVCELEIDGNVGSIQWYEVRLD |
| A0A396HA59 | 16-87 | None |
| A0A803LSJ5 | 470-556 | None |
| A0A6J5WZ55 | 80-166 | None |
| A0A843UXX2 | 257-328 | None |
| A0A835LLD0 | 146-217 | None |
| A0A2K1JBI0 | 118-189 | None |
| A0A1R3KSC5 | 18-102 | None |
| A0A4Y7JEL9 | 218-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.