DPCstruct | MC8211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 178 ± 38 aa |
| Standard deviation of domain lengths | 38.14 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.32 |
| Pfam Score | 99.38 |
| Assigned Pfam label(s) | PF00305- PF08263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0KDG4 | 55-225 | EEYVSFYYKSDEELQKDPELQAWWKELIEVGHGDLKDKPWWQKMQTREELVEASATLIWIASALHVAVNFGQYPYGGLILNRPTISR… |
| M1CAP7 | 11-185 | GDKKDEPWWPKMQTRQELIESCTITIWTASALHAAVNFGQYPYAGYLLNRPSLSRMFMPEPGSPEYEELKTNPDKVFLKTTVPPLQT… |
| A0A5P1F7K8 | 1-151 | None |
| A0A498MFY9 | 1001-1182 | None |
| A0A7J0GDF7 | 173-320 | None |
| A0A6S7GJH3 | 112-292 | None |
| A0A7N2L9N0 | 54-176 | None |
| A0A6V7PP87 | 143-292 | None |
| A0A2N9GJJ4 | 645-835 | None |
| G7INA1 | 18-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.