DPCstruct | MC821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 236 ± 31 aa |
| Standard deviation of domain lengths | 30.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532V820 | 4-235 | MEFEIVKQVVESKPRTAVKPREFFIAWSGVSTLAYQGFTRPLLGIKRELEQKIPGIKPENPGSKWPKTTLGALRDDRQLSWVDLNIL… |
| A0A150GZ91 | 2-220 | TLAYSGFPPPLLCLKDSINETVPGLTPEYSGSKWPKTSLGALHDKARLTPEQLERLNAICKEESAKLTQADDQAVLVDQMTVVFYEC… |
| A0A812TXB5 | 6-211 | None |
| A0A7S3CCU9 | 29-312 | None |
| C1EHG5 | 216-483 | None |
| C1MNI7 | 10-196 | None |
| A0A0S4KIL9 | 40-264 | None |
| A0A813LKM5 | 171-412 | None |
| A0A1Y2CRB8 | 46-278 | None |
| A0A813BDG0 | 2-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.