DPCstruct | MC8206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 16.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258T0S1 | 1-95 | MPQPTADEPTRRAFAKTTQDNFVQNGLDLQVTTSGPEATTIAIKFNFPAKTAVELIASGPFPRQCKQRGFKTIQFLDPNAISWTYDL… |
| A0A5R9KJE0 | 114-194 | PELRKSYVQSKESILKQENIQIANAGNRNEILVFTSEKFEPKASQKSFLKNINEIVHDLKFTKVIFKWSPDGKDSREYKIS |
| A0A2P6WBM7 | 175-262 | None |
| A0A1Z9YG43 | 246-328 | None |
| A0A3B8LNB0 | 305-379 | None |
| A0A2V7W9V1 | 1-114 | None |
| A0A3A5APW2 | 246-328 | None |
| A0A1G7VJU1 | 226-316 | None |
| A0A7C8AZ89 | 94-170 | None |
| A0A2V9VIC8 | 40-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.