DPCstruct | MC8205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 195 ± 23 aa |
| Standard deviation of domain lengths | 22.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6PH79 | 2-187 | ARLIDIRKAQLEYRNLHNGRYTASFDTLIDFVKTAKLPFVKKEGVLSDTQLEAGMTEKKAMAIINKAKKTGNWKEVEKEGLMNFKRD… |
| A0A2W1NSS2 | 51-281 | LRSFIGIGVTVLALAGAVFLLYKDYSIIKQDVDFNNRKELIFKEIKGRINDIKIAENEFKNEKGYYTANMDTLVNYVKTGYTIQYNR… |
| A0A496TNB5 | 10-193 | None |
| A0A358Y7S1 | 68-308 | None |
| S7XCF0 | 5-184 | None |
| A0A7J0B0I2 | 24-196 | None |
| A0A7X9PK23 | 3-184 | None |
| A0A412RWS8 | 8-227 | None |
| A0A1Q3GQD5 | 42-227 | None |
| A0A090W1P7 | 5-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.