DPCstruct | MC8204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 73 ± 2 aa |
| Standard deviation of domain lengths | 2.48 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.11 |
| Pfam Score | 69.05 |
| Assigned Pfam label(s) | CL0110- CL0536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5LND3 | 273-343 | MVLPGFWMDIGQPRDYIAGLRLYLDSLRKKSSTKLATGPHIVGNVLVDETAKIGEGCLIGPDVAIGPGCIV |
| A0A0N4U423 | 260-337 | FILPGFWMDVGQPKDFLTGMQFYLKYLHDRSPSQLASGHNIQGNVLIDQTAMINSGCVIGPNVVIGPRVRVENGVRLR |
| A0A654GRG7 | 227-298 | None |
| T0NMY6 | 680-750 | None |
| A0A5A7PQ18 | 1052-1122 | None |
| A0A6P8U3S8 | 176-246 | None |
| A0A5J4ZMM8 | 211-281 | None |
| A0A2P2KZD0 | 1-73 | None |
| A0A2Z7D9J2 | 257-333 | None |
| A0A2P2KZE2 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.